PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010094915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB_related
Protein Properties Length: 451aa    MW: 49319.8 Da    PI: 8.0819
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010094915.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-171457144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw
   XP_010094915.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRW 57
                     678***************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-21656IPR009057Homeodomain-like
PROSITE profilePS5129419.932965IPR017930Myb domain
SMARTSM007171.2E-101382IPR001005SANT/Myb domain
PfamPF002491.9E-141457IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-171481IPR009057Homeodomain-like
CDDcd001671.19E-101757No hitNo description
Gene3DG3DSA:1.10.10.609.7E-115797IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWSQI  60
AAQLPGRTDN EIKNLWNSCI KKKLRQKGID PNTHKPLSEV ENNYDNKDKP NSVMTSNILS  120
NNDNKANSVG SNELNLSAAD IAANSKHQQQ QQSPQQQQQT TTMAMDRFYT PVVVDQVSSS  180
TTTNSTGGSN VGNCCRPNSN SDFSSYFSFH PSDHLASNFC SFIGQNSRPN SSSNNSSNKI  240
INTISDHELI NSNNLSQMIS APTHQLPPSC SSIFSSSPRV KPSINLPSDQ NNNKHNWEAS  300
TFSSSNGGGS TSNGSSSSIE LQSHGSCNFF DNPTTTTTSF SWGLLDHTQK SDDQDIKWSE  360
FLHGPFQLLA NNNTTTTAST TAVQNQSSSS SSQANMYSTT AATSSNIVKP ETHFVISSGS  420
SATWHNQSEA SDQMYTSKDL QRLAVAFGQT L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2296183e-44KP229618.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB62) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094915.10.0Transcription factor
TrEMBLW9R5R00.0W9R5R0_9R
STRINGPOPTR_0005s00340.11e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.16e-61myb domain protein 61